Oct 2023 - Present
AeroLeads people directory · profile
Jerzy Dąbrowski Email & Phone Number
Członek Zarządu | Board Member
at
Finea S.A.
1 work email found
@finea.pl
LinkedIn matched
✓ Verified August 2026
3 data sources
Profile completeness 86%
Current company
Role
Członek Zarządu | Board Member
Location
Warsaw, Mazowieckie, Poland
Company size
Who is Jerzy Dąbrowski? Overview
A concise factual answer block for searchers comparing this professional profile.
Quick answer
Jerzy Dąbrowski is listed as Członek Zarządu | Board Member at Finea S.A., a with 8 employees, based in Warsaw, Mazowieckie, Poland. AeroLeads shows a work email signal at finea.pl and a matched LinkedIn profile for Jerzy Dąbrowski.
Jerzy Dąbrowski previously worked as Wiceprezes Zarządu | Vice Chairman of the Board at Faktoria Sp. Z O.O. Grupa Nest Bank and Dyrektor Generalny, Prezes Zarządu | CEO, Chairman of the Board at Bibby Financial Services Polska.
Company email context
Email format at Finea S.A.
This section adds company-level context without repeating Jerzy Dąbrowski's masked contact details.
*@finea.pl
71% confidence
AeroLeads found 1 current-domain work email signal for Jerzy Dąbrowski. Compare company email patterns before reaching out.
Profile bio
About Jerzy Dąbrowski
Jerzy Dąbrowski is a Członek Zarządu | Board Member at Finea S.A.. They possess expertise in factoring, trade finance, accounts receivable, corporate finance, credit risk and 2 more skills.
Listed skills include Factoring, Trade Finance, Accounts Receivable, Corporate Finance, and 3 others.
Current workplace
Jerzy Dąbrowski's current company
Company context helps verify the profile and gives searchers a useful next step.
Finea S.A.
10 roles
Jerzy Dąbrowski work experience
A career timeline built from the work history available for this profile.
Wiceprezes Zarządu | Vice Chairman Of The Board
faktoria.plspingo.pl
May 2021 - Sep 2023
Dyrektor Generalny, Prezes Zarządu | Ceo, Chairman Of The Board
bibbyfinancialservices.plplacefaktury.pl
Jan 2019 - May 2021
Dyrektor Generalny, Członek Zarządu | Ceo, Board Member
Jul 2015 - Dec 2018
Wiceprzewodniczący Komitetu Wykonawczego | Vice President Of The Executive Committee
Polski Związek Faktorów | Polish Factors Associationfaktoring.plwolnefaktury.pl
Mar 2015 - May 2021
Starszy Dyrektor, Dyrektor Departamentu | Senior Director, Head Of Department
Factoring & Trade Finance
Jun 2008 - Jun 2015
Zastępca Dyrektora Departamentu | Deputy Head Of Department
Factoring & Structured Finance
Apr 2006 - May 2008
Asystent Wykładowca | Assistant Lecturer
Institute of Economics (Intl. Economic Relations Dept.)
Oct 2001 - Jun 2006
Kierownik Zespołu | International Manager
UniCredit GroupInternational Factoring
Jan 2002 - Apr 2006
Analityk | Analyst
Bank Bgż
Sep 2001 - Dec 2001
Team & coworkers
Colleagues at Finea S.A.
Other employees you can reach at finea.pl. View company contacts for 8 employees →
FAQ
Frequently asked questions about Jerzy Dąbrowski
Quick answers generated from the profile data available on this page.
What company does Jerzy Dąbrowski work for?
Jerzy Dąbrowski works for Finea S.A..
What is Jerzy Dąbrowski's role at Finea S.A.?
Jerzy Dąbrowski is listed as Członek Zarządu | Board Member at Finea S.A..
What is Jerzy Dąbrowski's email address?
AeroLeads has found 1 work email signal at @finea.pl for Jerzy Dąbrowski at Finea S.A..
Where is Jerzy Dąbrowski based?
Jerzy Dąbrowski is based in Warsaw, Mazowieckie, Poland while working with Finea S.A..
What companies has Jerzy Dąbrowski worked for?
Jerzy Dąbrowski has worked for Finea S.A., Faktoria Sp. Z O.O. Grupa Nest Bank, Bibby Financial Services Polska, Polski Związek Faktorów, and Bank Millennium.
Who are Jerzy Dąbrowski's colleagues at Finea S.A.?
Jerzy Dąbrowski's colleagues at Finea S.A. include Rafał Kozielski, Joanna Rembelska, and Justyna Ignatowicz.
How can I contact Jerzy Dąbrowski?
You can use AeroLeads to view verified contact signals for Jerzy Dąbrowski at Finea S.A., including work email, phone, and LinkedIn data when available.
What skills is Jerzy Dąbrowski known for?
Jerzy Dąbrowski is listed with skills including Factoring, Trade Finance, Accounts Receivable, Corporate Finance, Credit Risk, Commercial Banking, and Credit Analysis.
Find 750M verified contacts
Search by job title, company, industry, location, and seniority. Export verified B2B contact data when you need it.
Start free trialPeople with similar names
Check these profiles if this is not the Jerzy Dąbrowski you were looking for.
View similar profiles
